HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Pituitary Adenylate Cyclase Activating Polypeptide White to off-white solid. HYGROSCOPIC. More active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50 = 7 nM). Purity: ≥96% by HPLC. Sold on the basis of peptide content. CAS 137061-48-4. H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 Ref.: Kobayashi, H., et al. 1994. Brain Res. 647, 145. Chastre, E., et al. 1991. J. Biol. Chem. 266, 21239. Le Meuth, V., et al. 1991. Am. J. Physiol. 260, G265. Kimura, C., et al. 1990. Biochem. Biophys. Res. Commun. 166, 81. |
