HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Pituitary Adenylate Cyclase Activating Polypeptide White to off-white solid. Supplied as a trifluoroacetate salt. HYGROSCOPIC. Increases cAMP levels in a dose-dependent manner (EC50 = 4.7 nM). Increases tyrosine hydroxylase expression in chromaffin cells. Purity: ≥98% by HPLC. Sold on the basis of peptide content. CAS 127317-03-7. H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 Ref.: Kobayashi, H., et al. 1994. Brain Res. 647, 145. Tatsuno, I., et al. 1990. Biochem. Biophys. Res. Commun. 168, 1027. | 
