Ant-BH3
RQIKIWFQNRRMKWKKMGQVGRQLAIIGDDINRRY Off-white lyophilized solid. Supplied as a trifluoroacetate salt. HYGROSCOPIC. PACKAGED UNDER INERT GAS. A cell-permeable Antennapedia-BH3 (Bcl-2 homology 3 domain from Bak) fusion peptide that binds to Bcl-xL and antagonizes its anti-apoptotic function. Reported to induce apoptosis in HeLa cells (~50 µM). Cell death is reported to occur via a cytochrome c-independent activation of caspases. Purity: ≥95% by HPLC. H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Met-Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg-Arg-Tyr-OH Ref.: Holinger, E.P., et al. 1999. J. Biol. Chem. 274, 13298. Cosulich, S.C., et al. 1997. Curr. Biol. 7, 913. | 
