CaM Kinase II Inhibitor 281-309
MHRQETVDCLKKFNARRKLKGAILTTMLA-OH Lyophilized solid. Supplied as a trifluoroacetate salt. HYGROSCOPIC. A synthetic peptide that contains the CaM-binding, inhibitory, and autophosphorylation domains of CaM kinase II. Can be phosphorylated at Thr286 by PKC. Useful as a calmodulin binding peptide. Inhibits CaM kinase II (IC50 = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site (IC50 = 2 µM). Purity: ≥97% by HPLC. Sold on the basis of peptide content. H-Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OH Ref.: Waxham, M.N., et al. 1993. Biochemistry 32, 2923. Waxham, M.N., et al. 1993. Brain Res. 609, 1. Fukunaga, K., et al. 1990. J. Neurochem. 54, 103. Colbran, R.J., et al. 1989. J. Biol. Chem. 264, 4800. Colbran, R.J., et al. 1988. J. Biol. Chem. 263, 18145. |
