AP-Cav-X
Pen-C1-SD-X
RQIKIWFQNRRMKWKK-WGIDKASFTTFTVTKYWFRY White lyophilized solid. Supplied as a trifluoroacetate salt. PROTECT FROM LIGHT. HYGROSCOPIC. PACKAGED UNDER INERT GAS. A scrambled caveolin-1 scaffolding domain peptide (C1-SD82-101) fused at the N-terminus to the Antennapedia internalization sequence (43-58). Serves as an useful negative control for studies using Caveolin-1 Scaffolding Domain Peptide, Cell-permeable (Cat. No. 219482). Purity: ≥95% by HPLC. H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Trp-Gly-Ile-Asp-Lys-Ala-Ser-Phe-Thr-Thr-Phe-Thr-Val-Thr-Lys-Tyr-Trp-Phe-Arg-Tyr-OH Ref.: Gratton, J.P., et al. 2003. Cancer Cell 4, 31. Sukumaran, S.K., et al. 2002. J. Biol. Chem. 277, 50716. Bucci, M., et al. 2000. Nat. Med. 6, 1362. | 
