 |
 | -20°C |  | Blue ice | | Note: Store and Ship conditions may differ. | | See Key |
|
 |
 |
| | Anti-Heme Oxygenase-1 Mouse mAb (HO-1-1) | |  | Cat. No. 374087 | |
Anti-HO-1 Anti-Hsp32 | Host: Mouse | | Isotype: IgG1 | | Immunogen: a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide | | Form: Liquid | | Formulation: In PBS, 0.1 mM PMSF, 50% glycerol. | | Comments: Recognizes the ~32 kDa HO-1 protein. | | Ref.: Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457. Maines, M.D. 1988. FASEB J. 2, 2557. Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131. | |
| Related information for this product is available: | |
| |
EMD Chemicals Inc. list price is displayed (pricing with local distributors may vary). NOTE: In Stock status is based on item availability worldwide.
| HO-1-1 | bovine, canine, human, monkey, mouse, rat | IB, IC, IP See Key |
|
|