 |
 | -20°C |  | Ambient | | Note: Store and Ship conditions may differ. | | See Key |
|
|
|
| | Anti-Heme Oxygenase-1 (1-30) Rabbit pAb |
|  | Cat. No. 374090 |
|
Anti-HO-1
Anti-Hsp32 | Host: Rabbit | | Isotype: IgG | | Immunogen: a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide | | Form: Liquid | | Formulation: Undiluted serum. | | Preservative: None | | Comments: Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. | | Ref.: Maines, M.D. 1988 FASEB J. 2, 2557. Kutty, R.K., et al. 1994. J. Cell Physiol. 159, 371. Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457. Trakshel, G.M., et al. 1986 J. Biol. Chem. 261, 11131. |
|
 | Related information for this product is available: | |
| |
EMD Chemicals Inc. list price is displayed (pricing with local distributors may vary). NOTE: In Stock status is based on item availability worldwide.
| | canine, hamster, human, monkey, mouse, rat | IB, IH, IP
See Key |
|
|
