 |
 | -20°C |  | Dry ice | | Note: Store and Ship conditions may differ. | | See Key |
|
 |
 |
 |
| | Anti-MAP Kinase ERK1/ERK2 (333-367) Rabbit pAb | |  | Cat. No. 442675 | |
Anti-Extracellular Signal-Regulated Kinases 1 and 2 | Host: Rabbit | | Isotype: IgG | | Immunogen: a synthetic peptide (CGGPFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to amino acids 333-367 of rat ERK1 MAP kinase with the CGG spacer group added, conjugated to KLH | | Form: Liquid | | Formulation: In PBS, 50% glycerol. | | Preservative: ≤0.1% sodium azide | | Positive Control: Rat adipose, brain, heart, intestine, kidney, liver, lung, muscle, spleen, testis or thymus tissue | | Comments: Recognizes the ~44 kDa ERK1 and the ~42 kDa ERK2 proteins in rat adipose brain, and heart tissue. | | Ref.: Hardie, F. and Hanks, S. 1995. in The Protein Kinase Facts Book p. 418, Academic Press, San Diego, CA. Charest, D.L., et al. 1993. Mol. Cell Biol. 13, 4679. Boulton, T.G., et al. 1990. Science 249, 64. | |
| Related information for this product is available: | |
| |
EMD Chemicals Inc. USD list price is displayed (pricing with local distributors may vary). NOTE: In Stock status is based on item availability worldwide.
| | chicken, clam, Drosophila, frog, human, mouse, rat, sea star, sheep | IB, IP, PS See Key |
|
|