 |
 | -20°C |  | Dry ice | | Note: Store and Ship conditions may differ. | | See Key |
|
 |
 |
| | Anti-Nicastrin, N-Terminal (62-93) Rabbit pAb | |  | Cat. No. 481906 | |
Anti-SP716 | Host: Rabbit | | Isotype: IgG | | Immunogen: a synthetic peptide (CQSSISGDTGVIHVVEKEEDLKWVLTDGPNPP) corresponding to amino acids 62-93 of human nicastrin, conjugated to KLH | | Form: Liquid | | Formulation: Undiluted serum. | | Preservative: None | | Comments: Recognizes the latent and active forms of nicastrin. | | Ref.: Leem, J.Y., et al. 2002. J. Biol. Chem. 277, 19236. Yu, G., et al. 2000. Nature 407, 34. | |
| Related information for this product is available: | |
| |
EMD Chemicals Inc. list price is displayed (pricing with local distributors may vary). NOTE: In Stock status is based on item availability worldwide.
* Additional Product Information
|
|