(RQIKIWFQNRRMKWKKSVIAGGPAADRLQL)
Ant-Tirap151-138
Mal Peptide
MyD88-Adapter Like Peptide
TIRAP Peptide, Control
Toll-interleukin 1 Receptor (TIR) domain-containing Adapter Protein Peptide White lyophilized solid. Supplied as a trifluoroacetate salt. PROTECT FROM LIGHT. HYGROSCOPIC. PACKAGED UNDER INERT GAS. A cell-permeable synthetic peptide containing mouse TIRAP151-138, reverse sequence, fused to the Drosophila Antennapedia sequence. Serves as a control for TIRAP Inhibitor Peptide (Cat. No. 613570). Purity: ≥97% by HPLC. H-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-Ser-Val-Ile-Ala-Gly-Gly-Pro-Ala-Ala-Asp-Arg-Leu-Gln-Leu-OH Ref.: Horng, T., et al. 2001. Nat. Immunol. 2, 835. | 
