Anti-TIL3 (Ab-1)
TLR5 (Ab-1)
Anti-Toll/Interleukin-1 Receptor-Like Gene 3 (Ab-1)

Host: Goat

Isotype: IgG

Immunogen: a synthetic peptide (DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ) corresponding to amino acids 151-181 of human toll-like receptor 5

Form: Liquid

Formulation: In PBS, 1 mg/ml BSA.

Preservative: ≤0.1% sodium azide

Positive Control: Human spleen or peripheral blood leukocytes

Comments: Recognizes TLR5 in human spleen and peripheral blood leukocytes.

Ref.: Gewirtz, A.T., et al. 2001. J. Immunol. 167, 1882. Hayashi, F., et al. 2001. Nature 410, 1099. Chaudhary, P.M., et al. 1998. Blood 91, 4020.